Protein Info for H281DRAFT_02315 in Paraburkholderia bryophila 376MFSha3.1

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF11638: DnaA_N" amino acids 2 to 66 (65 residues), 60.5 bits, see alignment E=2.6e-20 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 5 to 537 (533 residues), 557.6 bits, see alignment E=1.2e-171 PF00308: Bac_DnaA" amino acids 204 to 421 (218 residues), 285.7 bits, see alignment E=7.4e-89 PF01695: IstB_IS21" amino acids 240 to 341 (102 residues), 35.3 bits, see alignment E=2.3e-12 PF00004: AAA" amino acids 241 to 361 (121 residues), 29.3 bits, see alignment E=2.6e-10 PF08299: Bac_DnaA_C" amino acids 448 to 516 (69 residues), 110.4 bits, see alignment E=9.1e-36

Best Hits

Swiss-Prot: 96% identical to DNAA_PARXL: Chromosomal replication initiator protein DnaA (dnaA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 96% identity to bpy:Bphyt_0001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>H281DRAFT_02315 chromosomal replication initiator protein DnaA (Paraburkholderia bryophila 376MFSha3.1)
MNEFWQHCSALLERELTPQQYVTWIKPLAPVAFDAAANTLSIAAPNRFKLDWVKSQFSGR
IADMARDFWQTPVDVQFVLDPKAGMRAPAAAAPAAPRPASAPHSMGGSAGNGAAVDAAVG
AVQAAHAARANGANSAMANLNANARAAAEHNANARAAAEDSADLDLPSLDANEAAAARRT
WRPGQSASSNGNGDNDSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISYNPL
FLYGGVGLGKTHLIHAIGNQLLMDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHS
LDLLLIDDIQFFSGKSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDS
GLTVAIEPPELEMRVAILMRKAQSEFVSLNEDVAFFVAKHLRSNVRELEGALRKILAYSK
FHGREITIELTKEALKDLLTVQNRQISVENIQKTVADFYSIKVADMYSKKRPANIARPRQ
IAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG