Protein Info for H281DRAFT_02287 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PKHD-type hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF13640: 2OG-FeII_Oxy_3" amino acids 86 to 178 (93 residues), 49.9 bits, see alignment E=5.2e-17 PF18331: PKHD_C" amino acids 185 to 227 (43 residues), 68.5 bits, see alignment 4.2e-23

Best Hits

Swiss-Prot: 94% identical to Y5374_PARP8: PKHD-type hydroxylase Bphy_5374 (Bphy_5374) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 96% identity to bug:BC1001_0040)

Predicted SEED Role

"Iron-uptake factor PiuC" in subsystem Transport of Iron

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.11.-

Use Curated BLAST to search for 1.14.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M939 at UniProt or InterPro

Protein Sequence (228 amino acids)

>H281DRAFT_02287 PKHD-type hydroxylase (Paraburkholderia bryophila 376MFSha3.1)
MIVSIPDVFSPGDAAAMRAHLEASTDAWVDGRATAGYQGAPVKRNQQIAEGSPIALEMGD
RIIAALERHPLFISAVLPNKVYPPLFNRYEGGMHFGSHVDGAIRLVPGSGARVRTDVSVT
LFLTPPDEYDGGELLIEDTFGVQEVKLPAGHAIVYPGTSLHQVRPVTRGARVSSFFWAQS
LVRDDTQRAMLFDMDGAIQRLNASNADDAARRTLVGCYHNLLRMWSDT