Protein Info for H281DRAFT_02239 in Paraburkholderia bryophila 376MFSha3.1

Annotation: resistance to homoserine/threonine (RhtB) family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details PF01810: LysE" amino acids 17 to 211 (195 residues), 137 bits, see alignment E=2.8e-44

Best Hits

KEGG orthology group: None (inferred from 95% identity to bgf:BC1003_0072)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M937 at UniProt or InterPro

Protein Sequence (213 amino acids)

>H281DRAFT_02239 resistance to homoserine/threonine (RhtB) family protein (Paraburkholderia bryophila 376MFSha3.1)
MFGITHFEFFVVAVFLLNVTPGPDTAYIVGRSVAQGRGAGLMSALGISAGCCVHSLACAF
GLTALLAASATAFTVIKFVGAIYLIYLGVRLIFAKPAEDQARGEARGAGAPKSLRQLFLQ
GFWTNVLNPKVVLFFVSFFPQFVTAGTDHKALAFLTLGAVFVVMSMLWNSFVAWIAGSVT
RRFSGKPSVKKWLDRGVGSAFVGLGIKLATASR