Protein Info for H281DRAFT_02232 in Paraburkholderia bryophila 376MFSha3.1

Annotation: preQ(0) biosynthesis protein QueC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF06508: QueC" amino acids 10 to 233 (224 residues), 226.1 bits, see alignment E=1.7e-71 TIGR00364: queuosine biosynthesis protein QueC" amino acids 10 to 226 (217 residues), 197 bits, see alignment E=1.3e-62

Best Hits

Swiss-Prot: 96% identical to QUEC_PARXL: 7-cyano-7-deazaguanine synthase (queC) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06920, queuosine biosynthesis protein QueC (inferred from 96% identity to bpy:Bphyt_0317)

Predicted SEED Role

"Queuosine Biosynthesis QueC ATPase" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M740 at UniProt or InterPro

Protein Sequence (243 amino acids)

>H281DRAFT_02232 preQ(0) biosynthesis protein QueC (Paraburkholderia bryophila 376MFSha3.1)
VIRKDAKRSALVLFSGGQDSATCLAWALERYETVETLGFDYGQRHRVELECREGFRNAVV
RTFPAWSERLGDDHMIDLSVLGAISDTAMTRGIEIEATANGLPNTFVPGRNLMFMTIAAA
IAYRRGLQVLVGGMCETDFSGYPDCRDDTMKALQVALNLGMDTRLLLETPLMWLDKADTW
RLAHELGGDELVELVRIETHTCYVGERAELHAWGFGCGECPACRLRKRGYEAYLAGEKVT
EPV