Protein Info for H281DRAFT_02230 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01242: PTPS
  • amino acids 3 to 145 (143 residues), 106 bits, E=6.3e-35
• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 4 to 117 (114 residues), 95 bits, E=1.4e-31

Best Hits

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 96% identity to bph:Bphy_0045)

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

See A0A2Z5MFM4 at UniProt or InterPro

Protein Sequence (148 amino acids)

>H281DRAFT_02230  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase (Paraburkholderia bryophila 376MFSha3.1)
VLTITRKLEFDAGHRIPDHRSQCRNLHGHRYVIEITLQGDLVDTEGAPDRGMVMDFADVK
SLAVEHLVDKWDHAFLVYEGDTQVRGFLETMAGHKTVVLDRIPTVENLAAVAFAILANVY
DAHYGVNLRLHKLRLYETPNCWADVVRD