Protein Info for H281DRAFT_02205 in Paraburkholderia bryophila 376MFSha3.1
Annotation: transcriptional regulator, TraR/DksA family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to DKSA_CAUVC: RNA polymerase-binding transcription factor DksA (dksA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: K06204, DnaK suppressor protein (inferred from 94% identity to bmu:Bmul_3085)Predicted SEED Role
"C4-type zinc finger protein, DksA/TraR family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A2Z5M966 at UniProt or InterPro
Protein Sequence (139 amino acids)
>H281DRAFT_02205 transcriptional regulator, TraR/DksA family (Paraburkholderia bryophila 376MFSha3.1) MTTKRLLTEAEILKMSDKDYMNEDQLAFFKNKLEQLQADILRNAGQTTENLRETVIVPDP ADRATIEEEHALELRTRDRERKLLKKVQQSIARIDSGDYGWCEETGEPIGIPRLLARPTA TLSLEAQERRELRQKLFGD