Protein Info for H281DRAFT_02184 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MoxR-like ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF13401: AAA_22" amino acids 36 to 154 (119 residues), 28.3 bits, see alignment E=4.9e-10 PF07728: AAA_5" amino acids 38 to 192 (155 residues), 42.8 bits, see alignment E=1.3e-14 PF00004: AAA" amino acids 41 to 192 (152 residues), 35.8 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to bug:BC1001_0106)

Predicted SEED Role

"carbon monoxide dehydrogenase D protein" in subsystem CO Dehydrogenase or Carbon monoxide dehydrogenase maturation factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M741 at UniProt or InterPro

Protein Sequence (295 amino acids)

>H281DRAFT_02184 MoxR-like ATPase (Paraburkholderia bryophila 376MFSha3.1)
MHPVSIDDTLAQLAAQNYFASRELATALYLALRMDRPLFVEGEPGVGKTELAKAAAGMLD
TSMLRLQCYEGLDTASALYEWDYPRQIMALRLAEAAGRRPDNDTLYRGEFLLKRPLLQAL
MPDENHPGARRVLLIDEIDRADEPFEAFLLELLSDFQVSIPEYGTVRATQPPLVVMTSNR
TREVHDALKRRCLYQWIGYPERDRELEIVAARAPKTSAELQRRAVDFVHRLRGMDLFKAP
GIAETIDWCRALEALSVTELDPQSVQNTLGVLLKYQDDLARVDADQIAQCLAAPG