Protein Info for H281DRAFT_02150 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphoheptose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13580: SIS_2
  • amino acids 10 to 145 (136 residues), 130.8 bits, E=3.7e-42
• TIGR00441: phosphoheptose isomerase
  • amino acids 36 to 187 (152 residues), 209.6 bits, E=1.2e-66
• PF01380: SIS
  • amino acids 101 to 170 (70 residues), 25.4 bits, E=1.1e-09

Best Hits

Swiss-Prot: 73% identical to GMHA_AZOSB: Phosphoheptose isomerase (gmhA) from Azoarcus sp. (strain BH72)

KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 95% identity to bpy:Bphyt_0406)

Predicted SEED Role

"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (5/5 steps found)
• GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Galactose metabolism
• Inositol phosphate metabolism
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-

Use Curated BLAST to search for 5.-.-.- or 5.3.1.-

Sequence Analysis Tools

See A0A2Z5M765 at UniProt or InterPro

Protein Sequence (195 amino acids)

>H281DRAFT_02150 phosphoheptose isomerase (Paraburkholderia bryophila 376MFSha3.1)
MSVERIQQHFRDSAAVKLEALETLSMPIAAAIDTMFAALANGNRILACGNGGSAADAQHF
AAELIGRFERERPGLPAVALSTDTSVLTAIANDYSFEQIYSKQVWALGQPGDVLLAISTS
GNSANVIAAIEAAHEREMIVVALSGKGGGRMQEVLSDTDIHVCVPSDRTARIQEVHLLTI
HCLCDGIDAMLLGED