Protein Info for H281DRAFT_02125 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sodium/proton antiporter, CPA1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 transmembrane" amino acids 73 to 96 (24 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 261 to 286 (26 residues), see Phobius details amino acids 298 to 315 (18 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 356 to 376 (21 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 437 to 459 (23 residues), see Phobius details amino acids 475 to 499 (25 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 87 to 500 (414 residues), 198.6 bits, see alignment E=7.5e-63 TIGR00831: Na+/H+ antiporter" amino acids 89 to 625 (537 residues), 438 bits, see alignment E=2.3e-135

Best Hits

KEGG orthology group: K03316, monovalent cation:H+ antiporter, CPA1 family (inferred from 93% identity to bug:BC1001_0140)

Predicted SEED Role

"NhaP-type Na+/H+ and K+/H+ antiporters"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7J3 at UniProt or InterPro

Protein Sequence (630 amino acids)

>H281DRAFT_02125 sodium/proton antiporter, CPA1 family (Paraburkholderia bryophila 376MFSha3.1)
MADLAERQAALVESLSTPRGAVTLRRSNSQAKLAVYAWRSCCAARRTPTRHIPLACRPCE
VRRAGAKIFVRLSVIFPSLVPMEIVFTVLILLLAVAGSGVVTRLAPLPLPLVQIAIGAML
AWPKLRLHVTFDPEIFMMLFIPPLLFADGWRIPKREFFMARRSILMLALGLVFMTVLAVG
YFVHALVPSMSLPVAFALAAVLSPTDAVALSGIAGKGKIPGRLMHILEGEALMNDASGLV
ALKFAIAAALTGVFSLRDASISFVIIAAGGLATGAAVSWLFSFIAVRFLNLAEEGDPAPG
VIMTLLIPFAAYLIAERLELSGILAAVAAGMMMNYTTLATSGPVASRVRASSTWTMIEFV
FNGMVFILLGLQFPHILGRALLDAHETSNAQVGLLIGYIAAVAAALYTMRFVWVWLLRWF
ASRGAARQGVANAVPGLRTVGVTTVAGVRGAVTLAGVLSLPEMLPDGAPLPGRDLAIFIA
SGVILLSLVVAVFALPLLLRGWRRGKDPHAAEETLARVMAAQAAIRAVDDVHDKECANLD
ESASAYAADVTARVMDIYRRRLAALGEEREPREMARRADALEFRMKLSAMRAERQVLLSL
RSSQAINDETFNKLMREVDLSETALTARRK