Protein Info for H281DRAFT_02117 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF07221: GlcNAc_2-epim" amino acids 49 to 403 (355 residues), 369.9 bits, see alignment E=7.3e-115

Best Hits

KEGG orthology group: None (inferred from 95% identity to bgf:BC1003_0174)

Predicted SEED Role

"D-mannose isomerase (EC 5.3.1.7)" in subsystem Mannose Metabolism (EC 5.3.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M776 at UniProt or InterPro

Protein Sequence (427 amino acids)

>H281DRAFT_02117 Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family (Paraburkholderia bryophila 376MFSha3.1)
MTLSATPPSANGAPVVPAVASFRSREFLLSHVEDTLRFYAPNVFDSSGGFFHFFRDDGSV
YDKTTRHLVSSCRYVFNYAMAYRQFGDPKHLEYARHGLQFLRDAHWDGQHEGYDWEIEWS
DGRKRTLDATRHCYGLAFVLLAYSHAAMAGIEEAKPMIGATFELMEHRFWDAAAGLYADE
ASPEWRVSSYRGQNANMHTTEALLAAHEATGHLVYLDRAERVASNITLRQAKLSQGLVWE
HFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLILERYRPLPWLLPRAIELFDA
AMTHAWDEDHGGLYYGFGPDGTVCDHDKYFWVQAETFATAALLGKRTGNERFWDWYDEIW
RYSWAHFVDHKYGAWYRILTCDNRKYSDEKSPAGKTDYHTMGACYEVLTHALADGSTAAA
VSTEHAK