Protein Info for H281DRAFT_02065 in Paraburkholderia bryophila 376MFSha3.1

Annotation: rfaE bifunctional protein, domain II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02199: bifunctional protein RfaE, domain II
  • amino acids 23 to 157 (135 residues), 200.4 bits, E=1.2e-63
• TIGR00125: cytidyltransferase-like domain
  • amino acids 26 to 93 (68 residues), 44.2 bits, E=1.7e-15
• PF01467: CTP_transf_like
  • amino acids 28 to 130 (103 residues), 66.8 bits, E=1.1e-22

Best Hits

Swiss-Prot: 66% identical to HEPPA_BORBR: D-beta-D-heptose 1-phosphate adenylyltransferase (BB4463) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 94% identity to bxe:Bxe_A4229)

MetaCyc: 54% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"Glycerol-3-phosphate cytidylyltransferase (EC 2.7.7.39)" in subsystem Rhamnose containing glycans (EC 2.7.7.39)

MetaCyc Pathways

• 1-(sn-glycero-1-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
• poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
• poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.39

Sequence Analysis Tools

See A0A2Z5M7B3 at UniProt or InterPro

Protein Sequence (160 amino acids)

>H281DRAFT_02065 rfaE bifunctional protein, domain II (Paraburkholderia bryophila 376MFSha3.1)
MAAIFERKILTRDALVALRPSLNAPVVFTNGVFDILHRGHVTYLADAKAQGACLIVGVNS
DASVRMLGKGDDRPINNEADRMALLAALESVDYVVCFGEKTPVELISALRPDVLVKGGDY
DMDTLPESAIVRGWGGKALAIPFEHDRSTTALLKKVRTQG