Protein Info for H281DRAFT_02065 in Paraburkholderia bryophila 376MFSha3.1

Annotation: rfaE bifunctional protein, domain II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR02199: bifunctional protein RfaE, domain II" amino acids 23 to 157 (135 residues), 200.4 bits, see alignment E=1.2e-63 TIGR00125: cytidyltransferase-like domain" amino acids 26 to 93 (68 residues), 44.2 bits, see alignment E=1.7e-15 PF01467: CTP_transf_like" amino acids 28 to 130 (103 residues), 66.8 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 66% identical to HEPPA_BORBR: D-beta-D-heptose 1-phosphate adenylyltransferase (BB4463) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 94% identity to bxe:Bxe_A4229)

MetaCyc: 54% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"Glycerol-3-phosphate cytidylyltransferase (EC 2.7.7.39)" in subsystem Rhamnose containing glycans (EC 2.7.7.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7B3 at UniProt or InterPro

Protein Sequence (160 amino acids)

>H281DRAFT_02065 rfaE bifunctional protein, domain II (Paraburkholderia bryophila 376MFSha3.1)
MAAIFERKILTRDALVALRPSLNAPVVFTNGVFDILHRGHVTYLADAKAQGACLIVGVNS
DASVRMLGKGDDRPINNEADRMALLAALESVDYVVCFGEKTPVELISALRPDVLVKGGDY
DMDTLPESAIVRGWGGKALAIPFEHDRSTTALLKKVRTQG