Protein Info for H281DRAFT_02061 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phospholipid/cholesterol/gamma-HCH transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 135 to 160 (26 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 271 to 305 (35 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 171 to 384 (214 residues), 215.6 bits, see alignment E=4.6e-68 PF02405: MlaE" amino acids 173 to 381 (209 residues), 224.3 bits, see alignment E=6.7e-71

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 97% identity to bug:BC1001_0219)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8K4 at UniProt or InterPro

Protein Sequence (389 amino acids)

>H281DRAFT_02061 phospholipid/cholesterol/gamma-HCH transport system permease protein (Paraburkholderia bryophila 376MFSha3.1)
MAATPITTLQRSLNYDTPPGLEVAAGSQGKIVRLSGQWTALALARDRATGHVIPQLRSLE
GAEGIGQWDLSRIDRMDHVGGQALWRVWGHRMPPDTELTDTQRDIFERIALLDTVRETAE
PVVRFDPFTRLGLGLFSFFEHLYGGVAMLGRVVLDLLAIARKPALTPWTEISANIYNAGT
RALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAILVAGRSG
SAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIALSGGALA
AKIVLGIDMSYFARALPGVVPAANLWIGLGKGVVFGMLIAIVGCHFGFRIKANSQSLGEG
TTTSVVTSITIVILADAVFAILFQNVGLG