Protein Info for H281DRAFT_02046 in Paraburkholderia bryophila 376MFSha3.1

Annotation: phosphate:Na+ symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 69 (23 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 308 (308 residues), 296.5 bits, see alignment E=2.9e-92 PF02690: Na_Pi_cotrans" amino acids 13 to 147 (135 residues), 124.2 bits, see alignment E=4e-40 amino acids 155 to 240 (86 residues), 30.3 bits, see alignment E=4e-11 TIGR01013: sodium-dependent inorganic phosphate (Pi) transporter" amino acids 84 to 521 (438 residues), 312.8 bits, see alignment E=4.3e-97 PF01895: PhoU" amino acids 340 to 423 (84 residues), 54.7 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 57% identical to YJBB_ECO57: Uncharacterized protein YjbB (yjbB) from Escherichia coli O157:H7

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 96% identity to bxe:Bxe_A4205)

MetaCyc: 57% identical to putative inorganic phosphate export protein YjbB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-470

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9J4 at UniProt or InterPro

Protein Sequence (555 amino acids)

>H281DRAFT_02046 phosphate:Na+ symporter (Paraburkholderia bryophila 376MFSha3.1)
MLILLNLLAGVALLVWGSHIVRTGILRVLGADLRSILGRSTRSRWRAFLSGVGVTSLVQS
SNATAVIVTSFAAQGLLPLTSGLAIMLGADVGTALMARVLTLDLSWLSPILILFGVPLFL
SRKQTRTGQAGRTLIGLGLILLALHLIVEAAQPMMQGAGVRVMFGALTGDTMLDALVGAA
FAMLSYSSLAAVLLTATLASSGVISLKVALCLVIGANLGSGMLALLGTVAQNAAARRLAL
GSFAFKLAGAMLILPFAPLLARGLPVLIANPREATVGFHLIYNALRCCACLSLIDPVARV
CVRVLPDRPMPNGELRPLHLDEAALSTPTLALAHAAREVLRIGDIVRAMLDNVAELIHHN
HLDKARETIRMDDDVDELYAAVKNYLTLISREQLDEADSRRWTDIISLTINLEHAGDIIE
RIVGDIEEKKIAHRLSFSEEGLGELDDLQTRLVSNLQLGLSVFLNNDLRCAERLLAEKER
FRDLERAYSYRHLDRLTGQTLRSIETSALHLDLISDMKRLNSLFCSTAYPVLDAAGALHD
TRLRKRALDTMHVKE