Protein Info for H281DRAFT_02045 in Paraburkholderia bryophila 376MFSha3.1

Annotation: transcriptional regulator, DeoR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF08220: HTH_DeoR" amino acids 6 to 57 (52 residues), 51.5 bits, see alignment E=1e-17 PF08279: HTH_11" amino acids 9 to 47 (39 residues), 26 bits, see alignment 1e-09 PF00455: DeoRC" amino acids 73 to 234 (162 residues), 149.7 bits, see alignment E=1.1e-47

Best Hits

Swiss-Prot: 33% identical to YCIT_ECOLI: Uncharacterized HTH-type transcriptional regulator YciT (yciT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to bug:BC1001_0235)

Predicted SEED Role

"Transcriptional regulators of sugar metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8U9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>H281DRAFT_02045 transcriptional regulator, DeoR family (Paraburkholderia bryophila 376MFSha3.1)
MWQEDRHQRIRALVSTLHRVSTERIMADLGVSRETVRRDLLDLEALGELRRVHGGAIKPA
DEAPIAERAHMRVKSKTAIAKAATGLIASGQTLFIDAGTTTAALAEELAKLANLTIVTNS
IDVALKLRGAAEQADAGNEVILLGGTISDRAMATTGATTVLDIQRYRADLALLSPVGVDH
RHGATNYDHAETEVARAMVANADRVVILADYSKIGQRSRISYCPVERIDVLVTNKKAADA
ADFTALKKKLEEVVLA