Protein Info for H281DRAFT_02040 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 130.6 bits, see alignment E=9.9e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 35 to 350 (316 residues), 361 bits, see alignment E=2.6e-112 PF08402: TOBE_2" amino acids 276 to 351 (76 residues), 46.4 bits, see alignment E=5.3e-16

Best Hits

Swiss-Prot: 48% identical to POTA_NITEU: Spermidine/putrescine import ATP-binding protein PotA (potA) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 98% identity to bxe:Bxe_A4198)

Predicted SEED Role

"ABC-type spermidine/putrescine transport systems, ATPase components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M850 at UniProt or InterPro

Protein Sequence (356 amino acids)

>H281DRAFT_02040 putative spermidine/putrescine transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MAFLEIENLHKSFGTNIALHHFDMKIERGEFITFLGPSGCGKTTVLRMIAGFETPTRGVI
RLDNKDVTHLRTRQRKVGMVFQSYALFPNMTVAENIGFGLKITHRPQAEISQRVEEMLHL
IKLPQLGGRYPWQLSGGQQQRVALARALAGKPQVLLLDEPLSALDAKIRISLRQDIRALQ
RELGITSIFVTHDQEEALSISDRIVVMNEGRVEQIGSPSEIYNYPRTRFVASFVGTLNIL
AGHVIDPATGKMVVDGQELTTTQELPAGDAGKKRLLALRPEAIVLEPAAPGRNTLSATVE
EVNFLGAVVRIRTRVKDAVISLDVFNDPNRGLPERGQPVSLGFSHENLLVLEEGGA