Protein Info for H281DRAFT_02039 in Paraburkholderia bryophila 376MFSha3.1

Annotation: aerobic C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 242 to 267 (26 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 365 to 391 (27 residues), see Phobius details PF00375: SDF" amino acids 26 to 418 (393 residues), 374 bits, see alignment E=4.6e-116

Best Hits

Swiss-Prot: 96% identical to DCTA_PARXL: C4-dicarboxylate transport protein (dctA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 93% identity to bgf:BC1003_0252)

MetaCyc: 63% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MF60 at UniProt or InterPro

Protein Sequence (443 amino acids)

>H281DRAFT_02039 aerobic C4-dicarboxylate transport protein (Paraburkholderia bryophila 376MFSha3.1)
MMRSVAGHRLTHIAGTIVKKPIHKVLYVQVIVAIIIGIALGHYYPNLAVDMKPLGDGFIK
LIKMVIGPIIFCTVVTGIAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGV
GFNIDPATLDGKAVASYAAKAHGQTTVDFLMHLIPDTLVSAFAQGEILQILLIALLFGAV
LATAGERGKVVTNFIEGLSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLI
GTFYLTSIVFVVVVLGIIARAVGFNILRFIAYIKEEMLIVLGTSSSEAALPQLMLKLENL
GCSRSVVGLVVPTGYSFNLDGTNIYMTMAVLFIAQATNTDLTWAQQLTLLAVTMLTSKGA
SGVTGAGFITLAATLAVVPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEK
ELDRNKLNSALRGDVPVKEPAGV