Protein Info for H281DRAFT_02009 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PTS system, ascorbate-specific IIA component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03610: EIIA-man" amino acids 3 to 106 (104 residues), 58 bits, see alignment E=5e-20

Best Hits

KEGG orthology group: K02821, PTS system, ascorbate-specific IIA component [EC: 2.7.1.69] (inferred from 94% identity to bug:BC1001_0252)

Predicted SEED Role

"PTS system, mannose-specific IIA component"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7R8 at UniProt or InterPro

Protein Sequence (162 amino acids)

>H281DRAFT_02009 PTS system, ascorbate-specific IIA component (Paraburkholderia bryophila 376MFSha3.1)
MAGILIIAHAPFATALRDCISHIYGGLPARIGVIDVSPDCDPAQMVSFAESEIARLKEEN
GALVLTDMFGATPANIAGRLASVPDVRVLCGVNLPMLVRAVCYRATPLDTLVDKALAGAT
KGVHAIGPATPAPAESSAASADCLPALPCDAELVQKAGPAGL