Protein Info for H281DRAFT_02006 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Molybdopterin or thiamine biosynthesis adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00899: ThiF" amino acids 9 to 245 (237 residues), 232.8 bits, see alignment E=2.7e-73

Best Hits

Swiss-Prot: 44% identical to THIF_ECOLI: Sulfur carrier protein ThiS adenylyltransferase (thiF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to bge:BC1002_0258)

MetaCyc: 44% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7D9 at UniProt or InterPro

Protein Sequence (252 amino acids)

>H281DRAFT_02006 Molybdopterin or thiamine biosynthesis adenylyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MNDDQLLRYSRHILVDEIGIEAQQRFIDAHAIIVGAGGLGSPAAMYLAAAGVGRLTLVDA
DTVDLTNLQRQILHVSASVGRKKVESGRDTLAQINPEVTVNAVAERVDDAWLDRHVPAAT
VVLDCTDNFATRHAINRACVKHGVPLVSGAALRFDGQISTFDFRNEASPCYACVFPEDQP
FEEVACSTMGVFAPTVGIIGSMQAAEALKIIGEIGTPLVGRLTMLDSLRMEWTTMRIARQ
PDCPVCGQPHLP