Protein Info for H281DRAFT_02005 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carboxyl-terminal processing protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 56 to 387 (332 residues), 324.2 bits, see alignment E=4.5e-101 PF00595: PDZ" amino acids 104 to 171 (68 residues), 46.9 bits, see alignment E=6e-16 PF13180: PDZ_2" amino acids 105 to 184 (80 residues), 53.6 bits, see alignment E=4.7e-18 PF17820: PDZ_6" amino acids 121 to 171 (51 residues), 42.5 bits, see alignment 9e-15 PF03572: Peptidase_S41" amino acids 203 to 384 (182 residues), 185.8 bits, see alignment E=9.7e-59

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 99% identity to bug:BC1001_0256)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9L9 at UniProt or InterPro

Protein Sequence (525 amino acids)

>H281DRAFT_02005 carboxyl-terminal processing protease (Paraburkholderia bryophila 376MFSha3.1)
MRKNLKNIGLIAAGLATGVFATLQLSASAQQPASAAATPLPLDQLRLFAEVFGQIKHEYV
EPVDDKKLLTAAIKGMVSSLDPHSSYLDKTDYEELQEQTKGRFAGLGIEISSEDGLIKVI
SPIEDTPAFRAGIRPGDLITRINDKPVRGMTLDQAVKQMRGEPGTKVTLTIFRKTDDRTF
PLTVTRALIKVQSVKMKILAPGYAYVRITSFQERTTPDLAAKLQDIARQQPNLKGLVLDL
RNNGGGLLQSAVGVAGAFLPPNSVVVSTNGQIPDSKQVYRDTYDNYRLQSFDSDPLKDEA
PIFKTVPMIVLTNAYSASASEIVAGALQDQHRALIVGKTTFGKGSVQTVRPMTADTALRL
TTAYYYTPSGRSIQNKGIRPDIAVDQYAEGDPDDALVTREVDYSNHLANTQDPNEKKEAE
KREQDRMDQLRQLEEQNDKKTPEQRQKDRERKPVEFGSADDFMLAQALNKLEGKPVQESK
SLTERRLAQNKPATSASAPVAVKPTQPVPGASGAAPASAPATQSK