Protein Info for H281DRAFT_01999 in Paraburkholderia bryophila 376MFSha3.1

Annotation: O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF01661: Macro" amino acids 25 to 137 (113 residues), 160.7 bits, see alignment E=6.7e-52

Best Hits

Swiss-Prot: 62% identical to Y3693_PSEAE: Macro domain-containing protein PA3693 (PA3693) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 91% identity to bgf:BC1003_0273)

MetaCyc: 50% identical to 2'-O-acetyl-ADP-ribose deacetylase, regulator of RNase III activity (Escherichia coli K-12 substr. MG1655)
RXN0-7013 [EC: 3.1.1.106]

Predicted SEED Role

"COG2110, Macro domain, possibly ADP-ribose binding module"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7E7 at UniProt or InterPro

Protein Sequence (182 amino acids)

>H281DRAFT_01999 O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain (Paraburkholderia bryophila 376MFSha3.1)
MLNIGGCTLEARVADITTLDVDAIVNAANTSLLGGGGVDGAIHRAAGKELLGECEALGGC
ATGDAKLTRGYHLPARYVIHAVGPVWRGGTHGEADLLASCYQRSLEVAREANCASIAFPA
ISCGIYRFPADEAVRIAVQTVIENLPRMPQLEQVIFACFDHAMFERYQAELQRRQAPPSK
PV