Protein Info for H281DRAFT_01994 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 60 to 86 (27 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details PF02790: COX2_TM" amino acids 44 to 124 (81 residues), 63.8 bits, see alignment E=3.3e-21 TIGR02866: cytochrome c oxidase, subunit II" amino acids 51 to 274 (224 residues), 196.3 bits, see alignment E=2.1e-62 PF00116: COX2" amino acids 140 to 264 (125 residues), 113.2 bits, see alignment E=1.8e-36 PF13442: Cytochrome_CBB3" amino acids 298 to 368 (71 residues), 49.5 bits, see alignment E=1.1e-16 PF00034: Cytochrom_C" amino acids 299 to 366 (68 residues), 31.5 bits, see alignment E=9.2e-11 PF00691: OmpA" amino acids 447 to 520 (74 residues), 50.3 bits, see alignment E=6.6e-17

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 93% identity to bpy:Bphyt_0544)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7F1 at UniProt or InterPro

Protein Sequence (544 amino acids)

>H281DRAFT_01994 cytochrome c oxidase subunit 2 (Paraburkholderia bryophila 376MFSha3.1)
MEILGKEAMKTIKRALMGVLAMSGLLFAGAALAVGDVPGGPAVNEINLQPPATKIAEELY
SLHTFMLILCTVIFIGVFAVMFYSIFAHRKSKGHKASNFHESTTVEIIWTIVPFVIVVLM
ALPATKTVVAMKDTTNADVTIKVTGYQWKWGYDYVKGPGEGINFLSTLATPRAETDGRQP
ISTTYLQEVDNPLVVPVGKKIRIITTANDVVHSWYVPAFGVKQDAIPGFVRDTWFKADKV
GTFRGFCTELCGKEHAFMPVVVEVLSTDDYAKWVDTQKKKMAAGQDDPNKTYTMAELMER
GGKVYAANCAVCHQPTGKGAGAFPALDGSKVANGAIAEHVSIVLKGKNAMPSWAPTLNDV
EIASVVTFERNSWGNHTGDILQPKQVADARNGKLPEGGNHLADAGAAASGAEAASGAAAS
DASGAQAASAGSESAAASQAALPASVYFDTGKSTLPADAKAAVEAAAAYAKAHPDAKFTL
SGFTDASGSADTNAKLAKSRAEAVRDAVKAAGIAEDHIILKKPETITGGSDAKEARRVQI
SPAA