Protein Info for H281DRAFT_01986 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cytochrome c oxidase assembly protein subunit 15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 32 to 345 (314 residues), 286.2 bits, see alignment E=1.6e-89

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 95% identity to bxe:Bxe_A4163)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8P6 at UniProt or InterPro

Protein Sequence (369 amino acids)

>H281DRAFT_01986 cytochrome c oxidase assembly protein subunit 15 (Paraburkholderia bryophila 376MFSha3.1)
MFVLQLGLIGLCIALLPLSYVWVKADDNKFRKLVWLTTFLTLDLVMFGGFTRLTDSGLGC
PDWPGCYGTSSPFIAHAAITAAHQAMPTGPVSMTKAWIEMIHRYFAMAIGVLIIAQTVIA
WIARIKRRPLHVSPWWPTSLLLLILVQGAFGAWTVTMKLQPVIVTTHLLLGLALLGTLGW
LAARQTPLPAYEPEAARWRVAAVAGLVLLIVQIALGGWVSTNYAVLACTDFPTCNGQWVP
PMDFSHGFHLWRALGMTSSGDMITQDALVAIHWTHRTFALVVVGYLVWFALQLRRFESLR
RPANGVLLVVLIQFVTGLSNIVLQWPLPIAVAHNGGAAILLLLLVMLNFRIAYSRPGRAV
LPARDAAPA