Protein Info for H281DRAFT_01975 in Paraburkholderia bryophila 376MFSha3.1

Annotation: RNA polymerase, sigma 32 subunit, RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR02392: alternative sigma factor RpoH" amino acids 37 to 308 (272 residues), 412.7 bits, see alignment E=8.1e-128 PF00140: Sigma70_r1_2" amino acids 39 to 69 (31 residues), 28 bits, see alignment (E = 2.7e-10) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 71 to 306 (236 residues), 111.4 bits, see alignment E=3.5e-36 PF04542: Sigma70_r2" amino acids 76 to 145 (70 residues), 73.3 bits, see alignment E=1.7e-24 PF04545: Sigma70_r4" amino acids 249 to 304 (56 residues), 50 bits, see alignment E=2.5e-17

Best Hits

Swiss-Prot: 56% identical to RPOH_HAEIN: RNA polymerase sigma factor RpoH (rpoH) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 98% identity to bgf:BC1003_0298)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7G3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>H281DRAFT_01975 RNA polymerase, sigma 32 subunit, RpoH (Paraburkholderia bryophila 376MFSha3.1)
VSHALTLPSTLSPSSAKAAPAGALALSHSSLLPGQLGNIDAYIQAVNRIPMLTPAEERQF
ATEFREHDNLEAARRLVLSHLRLVVSIARNYLGYGLPHADLIQEGNIGLMKAVKRFDPEQ
NVRLVSYAMHWIKAEIHEYILRNWRMVKVATTKAQRKLFFNLRSHKQGLGAFTPDEIEGL
AKELNVKREEVAEMETRLSGGDIALEGQVEDGEESYAPIAYLADSHSEPTAVLASRQRDK
LQSDGIATALEALDARSRRIIEARWLKVEDDGSGGSTLHELADEFGVSAERIRQIEASAM
KKMRGALTEYA