Protein Info for H281DRAFT_01936 in Paraburkholderia bryophila 376MFSha3.1

Annotation: outer membrane lipoprotein LolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00548: outer membrane lipoprotein LolB" amino acids 20 to 209 (190 residues), 83.1 bits, see alignment E=1e-27 PF03550: LolB" amino acids 55 to 210 (156 residues), 133 bits, see alignment E=4.8e-43

Best Hits

Swiss-Prot: 44% identical to LOLB_CUPNJ: Outer-membrane lipoprotein LolB (lolB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 92% identity to bug:BC1001_0302)

Predicted SEED Role

"Outer membrane lipoprotein LolB precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7H7 at UniProt or InterPro

Protein Sequence (210 amino acids)

>H281DRAFT_01936 outer membrane lipoprotein LolB (Paraburkholderia bryophila 376MFSha3.1)
MRISRFNSFSWAPRRAALGLAAAAVVTLVGCASVKPQGPSTSNAATAVTAQTSRAYQGRF
AVQYNDQNGQQRNAYGNFSWQETGDTVTLQLRNPLGQTLAIVTSSPASATLELPNRQPLT
ADNVSTLMQNALGFALPVEGLRYWLQPSPAPTSRAKTERDPEQPSRFKEITQDGWTIDYL
AYAEAPATGVKRVNLTRSEPPLDIKLVLDQ