Protein Info for H281DRAFT_01929 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PTS IIA-like nitrogen-regulatory protein PtsN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00359: PTS_EIIA_2" amino acids 27 to 168 (142 residues), 119.4 bits, see alignment E=1.2e-38 PF07565: Band_3_cyto" amino acids 88 to 163 (76 residues), 34.8 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 96% identity to bge:BC1002_0319)

Predicted SEED Role

"PTS system nitrogen-specific IIA component, PtsN"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M9S0 at UniProt or InterPro

Protein Sequence (171 amino acids)

>H281DRAFT_01929 PTS IIA-like nitrogen-regulatory protein PtsN (Paraburkholderia bryophila 376MFSha3.1)
MERQSIAPARRTQATFSPVNMNRLAKFLPLENVVVGLSVTSKKRVFEQAGLIFENQNGIA
RSTVTDNLFARERLGSTGLGEGVAIPHGRIKGLKQPLAAFVRLAEPIPFESPDGQPVSLL
IFLLVPEQATQQHLEILSEIAQLLSDREARERLHTEEDRESLHRLLTQWQP