Protein Info for H281DRAFT_01925 in Paraburkholderia bryophila 376MFSha3.1

Annotation: lipopolysaccharide export system protein LptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR03002: lipopolysaccharide transport periplasmic protein LptA" amino acids 42 to 196 (155 residues), 140.3 bits, see alignment E=1.9e-45 PF03968: LptD_N" amino acids 51 to 170 (120 residues), 94.6 bits, see alignment E=2.4e-31

Best Hits

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 96% identity to bpy:Bphyt_0598)

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7I7 at UniProt or InterPro

Protein Sequence (223 amino acids)

>H281DRAFT_01925 lipopolysaccharide export system protein LptA (Paraburkholderia bryophila 376MFSha3.1)
MNESFPRFHTGRSRTLSACRAGLAALIVALPLAGFAPLAHADRADKDKPLNIEADNMTYD
DLKQVNIFTGHVVATKGTIVIKADRVDVTQDPQGYQYATGTSTGGNLSYFRQKREGLDEY
IEGTAVRIDYDGKQDLTTLTTNATVKRLQGLSTVMDQVHGSVITYDGQKDFYTAKAGKDV
AGPGNPSGRVRAMLSPRNGGAAPLNGASATLAPSTTIQGAPNQ