Protein Info for H281DRAFT_01924 in Paraburkholderia bryophila 376MFSha3.1

Annotation: lipopolysaccharide export system protein LptC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 9 (9 residues), see Phobius details transmembrane" amino acids 10 to 26 (17 residues), see Phobius details TIGR04409: LPS export ABC transporter periplasmic protein LptC" amino acids 9 to 187 (179 residues), 168.3 bits, see alignment E=6.2e-54 PF06835: LptC" amino acids 12 to 188 (177 residues), 155.3 bits, see alignment E=6.3e-50

Best Hits

KEGG orthology group: K11719, lipopolysaccharide export system protein LptC (inferred from 95% identity to bug:BC1001_0314)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M7L7 at UniProt or InterPro

Protein Sequence (199 amino acids)

>H281DRAFT_01924 lipopolysaccharide export system protein LptC (Paraburkholderia bryophila 376MFSha3.1)
MNQFRLTSLIPLVAMAALAGITWWLLQATLPRQNEGAVRPKEHTPDYFADNFSVSELDQS
GSTQYRLTAQSLVHYEDDELSDLVKPAMRAFQPGKPIVTATGDTGKVNGDASIVDLYGNA
RILRAPGYGDPQMQADSEHFRVLVNDDVIETEKPVKLQRGVSVMTASGMNYNNVTRVMQL
FGNVKGAIAASDAGGSSPK