Protein Info for H281DRAFT_01920 in Paraburkholderia bryophila 376MFSha3.1

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 16 to 182 (167 residues), 211.3 bits, E=5e-67
• PF00156: Pribosyltran
  • amino acids 39 to 164 (126 residues), 47.2 bits, E=7.7e-17

Best Hits

Swiss-Prot: 94% identical to APT_PARPJ: Adenine phosphoribosyltransferase (apt) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 94% identity to bpy:Bphyt_0603)

MetaCyc: 51% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• adenine salvage (3/3 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenine and adenosine salvage I (1/2 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)
• glyphosate degradation III (3/7 steps found)
• (aminomethyl)phosphonate degradation (3/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

See A0A2Z5M8T2 at UniProt or InterPro

Protein Sequence (188 amino acids)

>H281DRAFT_01920 adenine phosphoribosyltransferase (Paraburkholderia bryophila 376MFSha3.1)
MSNALVSAPLDAADYIKSHIRTVPDWPQAGVQFRDITPLLQEPKSLRVLIDLFVQRYIDA
KLDYIAGLDARGFIIGPILAYELNLGFIPIRKEGKLPYKRASQSYELEYGTATVEIHEDA
CKPGDRVVIIDDLIATGGTMMAGKILLERLGAIVVEGAAIIDLPELGGTKLLADGGLSLY
TVTSFDGH