Protein Info for H281DRAFT_01909 in Paraburkholderia bryophila 376MFSha3.1

Annotation: methyl-accepting chemotaxis sensory transducer with TarH sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 187 to 209 (23 residues), see Phobius details PF02203: TarH" amino acids 1 to 178 (178 residues), 113.2 bits, see alignment E=2.8e-36 PF12729: 4HB_MCP_1" amino acids 4 to 189 (186 residues), 62.2 bits, see alignment E=9.6e-21 PF00672: HAMP" amino acids 213 to 264 (52 residues), 41.2 bits, see alignment 3.4e-14 PF00015: MCPsignal" amino acids 328 to 484 (157 residues), 183.3 bits, see alignment E=7.3e-58

Best Hits

KEGG orthology group: None (inferred from 90% identity to bgf:BC1003_0340)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8T8 at UniProt or InterPro

Protein Sequence (550 amino acids)

>H281DRAFT_01909 methyl-accepting chemotaxis sensory transducer with TarH sensor (Paraburkholderia bryophila 376MFSha3.1)
MLKNLSIRSCLTLMIAFFAAALLLGAAAGLLSLRSSNASLQQMYTVDTPAVADLEGSAGQ
LLRLRLALATYASLVDLNDQDGANAVLKRFDQYQKASNERLAHYVSRASAEADEQRLIKD
MQDKRGTFLREGVEPALAALKAGDRTAFQQLQAKKLPSLYSSFEKAMLALEQLQLDHAEQ
RYQSAQALFYAICVTVAIGIGISLLGSLLGRAVLVRAIVSPVDATIAQFQRIANGDLTGQ
IVVTSSNEMGRLAAALRKMQESLIATVNSVRQGTESIDSGVSEIAAGNTDLSQRTEEQAA
SLEETAASIEQLTSTVKQTADNAKQASSLAQGASTLAAQGGELTEQVVGTMHEIVDDSRR
IADIVGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAAAAKEIKAL
IEASTTRVENGSQLVERSGSTMTEIVQAISRVSSIMGEIAAAATEQSTGIDQVNLAVAQM
DEVTQQNAALVEQAAAAASSLEEQARRLTSAVAVFQTEGGSSSRGLAGSRNGQSAATKRA
ANGVDELVVA