Protein Info for H281DRAFT_01889 in Paraburkholderia bryophila 376MFSha3.1

Annotation: 7-cyano-7-deazaguanine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR03138: queuine synthase" amino acids 3 to 274 (272 residues), 399.7 bits, see alignment E=7.4e-124 PF14819: QueF_N" amino acids 14 to 123 (110 residues), 157.7 bits, see alignment E=1.3e-50 PF14489: QueF" amino acids 187 to 260 (74 residues), 83.1 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 94% identical to QUEF_PARXL: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K06879, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 94% identity to bpy:Bphyt_0643)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5M8V8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>H281DRAFT_01889 7-cyano-7-deazaguanine reductase (Paraburkholderia bryophila 376MFSha3.1)
MTPEQSPLGKASTYTEQYDASLLFPIARSNARDAIGIGAQLPFFGTDIWNAYELSWLNQR
GKPQIAVATFFVPAESPNIVESKSFKLYLGSFAQTAFESIDVVRDTIKRDVSASCGATVS
VHLTAPHDFGKLQMEEFEGMSLDRLDLDTDVYHPDASLLKAALDEAPVEETLFSNLLKSN
CPVTGQPDWGSVQIHYVGPQIDHAGLLRYIISYRNHTGFHEQCVEKIFIDVLKACKPVKL
AVYARYTRRGGLDINPFRTNYNLPMPDNMRLARQ