Protein Info for H281DRAFT_01875 in Paraburkholderia bryophila 376MFSha3.1

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details amino acids 94 to 119 (26 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 311 to 337 (27 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details amino acids 386 to 406 (21 residues), see Phobius details TIGR00155: integral membrane protein, PqiA family" amino acids 4 to 417 (414 residues), 273.7 bits, see alignment E=1.5e-85 PF04403: PqiA" amino acids 46 to 198 (153 residues), 139 bits, see alignment E=6.1e-45 amino acids 262 to 417 (156 residues), 179.9 bits, see alignment E=1.6e-57

Best Hits

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>H281DRAFT_01875 paraquat-inducible protein A (Paraburkholderia bryophila 376MFSha3.1)
MTHARLLACHECDLLQVDADLPDGGVLRCRRCHGELYRNRANSLGNALALSLGAAVLLAI
ANSYPIVGLSVNGTLVETTLIGAVDVLYIDGMWPIALLVFLTTVAIPAVQVASMLWMLIP
LRFNRVPWGAATVFRLARLAQPWGMTEVLIIGLLVALVKLAHIASVVVDVGLWSFGILML
VLAAASAAFDSRDLWARITALQNPGGQTGGSLSLPCGWLSAAQCGLMQCHDCGLLVKAPA
HAKGLCCSRCGASVHFRKPDSLARTWAFLLAAMVLYIPANVLPVMYTSSLFGAEKDTIMS
GVVYLWTSGSWLLALVVFVASVAVPMLKIIAIAFLSISTQVHSRWNPEQRTRIYRVVELV
GRWSMLDIYVITMLVALVQFKALATIQAGLAAVAFGAVVVLTMFAAMSFDSRLIWDADGP
DHAGQLKHA