Protein Info for H281DRAFT_01843 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Predicted arabinose efflux permease, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 232 (212 residues), 85.3 bits, see alignment E=7.9e-28 amino acids 250 to 392 (143 residues), 55.1 bits, see alignment E=1.2e-18 PF12832: MFS_1_like" amino acids 40 to 377 (338 residues), 25.8 bits, see alignment E=1.1e-09 PF00083: Sugar_tr" amino acids 49 to 191 (143 residues), 35.7 bits, see alignment E=9.6e-13 amino acids 227 to 382 (156 residues), 28 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to bug:BC1001_5022)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>H281DRAFT_01843 Predicted arabinose efflux permease, MFS family (Paraburkholderia bryophila 376MFSha3.1)
MQARIRISVLSSIPRSVWVLGCVSLCMDISSEIVHSLLPMFLTVSLGASAATIGLIEGIA
EATAPIVKVFSGALSDYLGNRKWLAVAGYALGALSKPLFAIAPTVGVVVSARVIDRVGKG
IRGAPRDALVADVTPVHLRGAAFGLRQSLDTIGAVLGPLFAVVIMSVWADNFRLAFWLAV
IPGVLAVALLMVGIHEPAREAGAKRVNPVRLENLKKLGARYWWVVAIGAVFALARFSEAF
LVLRAMGSGVPIALVPLVMVTMNIVYSLSAYPFGKLADTMNHKRLLIAGVVVLIASDLVL
AHGSHWSIVLLGVALWGLHMGMTQGLLATMVSHTAPAQLRGTAFGFFNLLGGVVTLLSSV
IAGELWDKIGATATFYAGAVFCVATIALLVAGKAPDTRATSH