Protein Info for H281DRAFT_01818 in Paraburkholderia bryophila 376MFSha3.1

Annotation: filamentous hemagglutinin family N-terminal domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details PF05860: TPS" amino acids 42 to 295 (254 residues), 89.1 bits, see alignment E=4.9e-29 TIGR01901: filamentous hemagglutinin family N-terminal domain" amino acids 77 to 146 (70 residues), 57.1 bits, see alignment E=6.6e-20 PF07581: Glug" amino acids 623 to 643 (21 residues), 19.5 bits, see alignment (E = 1e-07)

Best Hits

KEGG orthology group: None (inferred from 84% identity to bgf:BC1003_4955)

Predicted SEED Role

"Large exoproteins involved in heme utilization or adhesion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (754 amino acids)

>H281DRAFT_01818 filamentous hemagglutinin family N-terminal domain-containing protein (Paraburkholderia bryophila 376MFSha3.1)
MIKTSPAGYDLGNSRRRGARIALLPLAAALLCCVASIEARAAGALPAGGSFVRGNGSISG
DGTTVTINQGSSRGVVDWNSFSIGSGNRVVFANGNGSTLNRVTGGSPSAIMGTLTASGSV
YLINPQGILVGSGGVISTNGRFVASTLNVVDIDAFMNGQPLTLAGNSGASIVNMGTIGSG
TGDVFLIARQRVANAGTISAPNGTVELAVGQQVLLQDSSSGRQVFVQPGQQGAGGTIANS
GLIEAAQVSLQAVDGNIYALAGNNEAIRATGTTTRDGHVWLVAGHGTLQPGGTIEATGGT
VDMSADTVAFPTGGATVRANQWNIATPAFTVDGNAAQALSTSLGTGTSVNVQTTGANGST
GDINVNSGIGWQGNASLTLAAYRNLTIAQGATVGNQGGGSLTLRADSASIDNGGSVANRG
VIDWSRSTGLVNALYDMNGTYSPGTLLANTAWAAAAGSGQITQITAYKLVNNVTDLQNIS
QDLAGNYALGTDIDATGYTLTPIGNHTTPFTGQFDGMWHNVRNAKIEIADFSTDYSAGLF
GLVGQTGVLRDVGVENGSVSTSHSGSGLLAGVNQGTIANAHSTGVAMELFQNGTTFGGLV
GRNDGNIERSWSSASVSGSDANGGLVGYNLGSITQSYATGSVSPVFSTGYGGGLVGINEG
TVAQSFATGAVQTQRMPTHGVIAFGSGTLAPDVYWNKETTGQPASGGSLPPSNGLTTAQM
SDPANFAGYDFGPNGVWAMPSGATQPVLRWQLAH