Protein Info for H281DRAFT_01789 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MOSC domain-containing protein YiiM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 586 transmembrane" amino acids 346 to 365 (20 residues), see Phobius details PF03473: MOSC" amino acids 51 to 161 (111 residues), 112.9 bits, see alignment E=2.4e-36 PF03475: YiiM_3-alpha" amino acids 171 to 213 (43 residues), 47.3 bits, see alignment 3.7e-16 PF00970: FAD_binding_6" amino acids 242 to 337 (96 residues), 32.9 bits, see alignment E=1.8e-11 PF00175: NAD_binding_1" amino acids 348 to 456 (109 residues), 43.5 bits, see alignment E=1.1e-14 PF00111: Fer2" amino acids 522 to 579 (58 residues), 29 bits, see alignment 2.1e-10

Best Hits

KEGG orthology group: None (inferred from 63% identity to afw:Anae109_2815)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.17

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (586 amino acids)

>H281DRAFT_01789 MOSC domain-containing protein YiiM (Paraburkholderia bryophila 376MFSha3.1)
MARLLSVNVGLPRDIEWKGRTVYTGIWKSPVQGRCWAARLNLAGDGQGDLAGHGGEQRAV
FVYQTDSYRHWQQELNRSDFVHGQFGENFTVEGLPDALVCVGDRYRIGNALFEVTQPRVT
CYRVGIRMNEPRMPALLTSSGRPGFYLRVVQEGEVGAGDEIVKVGEAEEQMTVAQINALL
YSPDHPLDLLERALRIKALSPGWRSSFEALLQSRTTGAESGNAGLAPAAARHAVQPGFRP
LTVAAIDEESADVVSFTLKSADGQLQPALPGQYLVLRLQPTADGPPLFRSYSLSGPLSAE
SYRISVKIEPNGLAGAWLRSHVHAGDTLDVSSPRGSFVLQPGDGPIVLLSAGIGATPVLA
MLHALSSQQSTRQVLWLHTARDRQHHPFAVEARRLMLALAHGRSYVSYSAAGPNDRLGED
FDATGRLSQQILSEVGVFRDADVYLCGPAPFMADMKKALAALEIAPERIHAETFNGGESL
NPGIVDSQKRTPHRPINEASTGPLVSFARSGIAARWNGSTYQSILELAEACDVPVRWSCR
TGVCHNCESGLVSGSISYDPDPLDPPARGNVLICCCKPQDDVVIDI