Protein Info for H281DRAFT_01764 in Paraburkholderia bryophila 376MFSha3.1

Annotation: cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 138 to 168 (31 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details PF00510: COX3" amino acids 29 to 199 (171 residues), 92.5 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 77% identity to bxe:Bxe_A2185)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>H281DRAFT_01764 cytochrome c oxidase subunit 3 (Paraburkholderia bryophila 376MFSha3.1)
MRGPVMSELTDNVPVLPVGSAGKLSSGWWGMMATVATEASLFGYLIFSYLYLGSQTEMHW
PPEGLPKIGIGALNTCVLLLSSLFVWLGERLVRRRRIRWAVASMALAIVLGVVFVGIQMK
EWHDHPYGIATHLYGSLYFTITGFHVIHVLVGLIVLSCLLGWTALGYFDEKRCAALRIGG
LYWHFVDVVWLFIFTTLYVTPFLF