Protein Info for H281DRAFT_01762 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Cytochrome c, mono- and diheme variants

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00034: Cytochrom_C" amino acids 55 to 152 (98 residues), 22.9 bits, see alignment E=1.8e-08 amino acids 344 to 429 (86 residues), 48.1 bits, see alignment E=2.5e-16 PF13442: Cytochrome_CBB3" amino acids 342 to 425 (84 residues), 33.4 bits, see alignment E=4.6e-12

Best Hits

KEGG orthology group: None (inferred from 66% identity to bge:BC1002_3299)

Predicted SEED Role

"Putative diheme cytochrome c-553" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>H281DRAFT_01762 Cytochrome c, mono- and diheme variants (Paraburkholderia bryophila 376MFSha3.1)
MTDMKRIGPRAAFTAFALTLAMTMVAALCAHSLAQSDSPSVDDEVSLSDPALISRGAYLA
KLGDCAGCHTVPKQGAPFAGGLPMGSPFGTIYSTNITPDPQTGIGRYSYADFERALRDGV
APGGKRLYPAMPYASFTKINDSDMHALYAYFMHGVQPVAHRPPETKLPFPFSQRWGLAFW
DFAFVQHERFIPDGKRDALWNRGAYIVQSLGHCGACHTPRGPGFEERGYDESSKLYLTGG
TNDHWFAPNLTGDPGSGLGRLSPRDIASFLKSGHGVDVHVVTFGSMVEVVEDSGQYFSDD
DLNAVARYLKSLPARQSSGAYKPNTQKLQETAVSLKAGEVERPGAGLYMSFCAKCHQADG
RGEPHKFPALAGNPAVLAPDTSSLIRLVLEGGTSPQTENGPIHREMPAFRNQFTDREIAR
VLSFVRTAWGNEARPVATRDVSTVRSKIKK