Protein Info for H281DRAFT_01718 in Paraburkholderia bryophila 376MFSha3.1

Annotation: aerobic C4-dicarboxylate transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 69 (26 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 302 to 329 (28 residues), see Phobius details amino acids 334 to 363 (30 residues), see Phobius details PF00375: SDF" amino acids 13 to 405 (393 residues), 378.3 bits, see alignment E=2.3e-117

Best Hits

Swiss-Prot: 55% identical to DCTA_ANASK: C4-dicarboxylate transport protein (dctA) from Anaeromyxobacter sp. (strain K)

KEGG orthology group: None (inferred from 94% identity to bcm:Bcenmc03_2501)

MetaCyc: 55% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Na+/H+-dicarboxylate symporters" in subsystem Propionyl-CoA to Succinyl-CoA Module

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>H281DRAFT_01718 aerobic C4-dicarboxylate transport protein (Paraburkholderia bryophila 376MFSha3.1)
MLVSKVRKTLSKLYLQVLIGIIAGILLGHFYPDVGSQLKPLGDLFIKLIRMLLAPIIFAS
VVVGIARMNDLHEAGRVGVKALLYFEVASTIALLVGMVVVNVFKPGAGMNVDPSHIDGSA
ISTYTTAARQHGMLDFFTSIVPNSIVGAFANGEMLPIIFFSLLLAISLARLGPRTAPFVD
MLDMFLQGMFGVVRIVMYVAPIGAFGGMAFTIAKYGIGTLASFGQLMLCLYLTSIFFVVV
VLGLVMRMCGLSLFKYLRYIKDEILITLGTASTEAVLPQMLVKMERMGCSRPVVGMVLPT
GYTFNADGTAIYLTMAALFIAQAMNVHLTIWDQLLVLGVLLLTSKGSAGVAGAGFVALAA
TLASMHKIPVEGLVLLLGVDRFLNEARAVTNLIGNGVATVVVARWEGQLDMNTARAVLNR
TYVAEFEELQPIDNPAIASASTGDASVRSNAH