Protein Info for H281DRAFT_01715 in Paraburkholderia bryophila 376MFSha3.1

Annotation: sulfate permease, SulP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 376 to 406 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 18 to 380 (363 residues), 302.7 bits, see alignment E=3.3e-94 PF01740: STAS" amino acids 438 to 537 (100 residues), 42.2 bits, see alignment E=5.9e-15

Best Hits

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>H281DRAFT_01715 sulfate permease, SulP family (Paraburkholderia bryophila 376MFSha3.1)
MREMLEPQSTKSSPMIGRGDIFGGVAAGVVALPLALAFGVASGLGPVAGLYGAIVTGIVA
ALFGGTPVQITGPTGPMTLVVAGVLAANMHSSGSANLPLVVGIFVVAGFMQIAFGLLRIG
SYIRYVPYPVISGFMSGIGVIIITQQVFPMFGANAPGSDPWSILSQLHLLGGNIKWSAVA
LSASTIAIALLLPRFTKVIPASLVALIVLTITAVMLKLDVPVIGEIPSGLPTLTMPAFDL
HRLPSLVPAALQLSLLGAIDSLLTALVADNLTRTRHDSNRELIGQGLGNIAAAVIGGLPG
AGATMRTVVNVDAGGRTRLSGVIHGLFLAAVLLGLSGLLQHVPRAILAGLLVTVGIGIID
RRSFRHLLKLSRSDAFLMLLVLALTVFTDLIIAVATGLVVASFVFVKKVGDITEQRTMLT
PVADEPWADELTIPAGLRDRLLIKHVDGPIFFGFASKFLDIARQATLLSRLLVLRMDRIS
YMDQTGVYALDDALVRLNAAGVRVLVVGVSVSQRDLLERLQVIPAVVPERDIFNNFDELR
KALPVIIGDLHAK