Protein Info for H281DRAFT_01711 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Na/Pi-cotransporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 75 (29 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details PF02690: Na_Pi_cotrans" amino acids 16 to 149 (134 residues), 130.6 bits, see alignment E=2e-42 amino acids 159 to 244 (86 residues), 60.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 36% identity to bbe:BBR47_20390)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>H281DRAFT_01711 Na/Pi-cotransporter (Paraburkholderia bryophila 376MFSha3.1)
MTPIQGLFAAVSAVLLFLYGLQGFSRELQDVGGTALQSWLGRVTASRWLGFLVGALATAI
VQSSSAITALAVTLVDASVISFRASLGILLGSNVGTTATAWLVSFKLTGIGPVFIVLGAL
ISVLPVRARYIGKAVFYFGLIFFALDLISAELKPLQERPQFKAWLALAEAPWAGVLAGLV
FTALVQSSSVTTGLAILLVQQGVLPPQAAIPIVIGSNVGSTSTALIAGLGMSSVARATAI
TNFLFNAAGVLCYFPFLRSFSRAMVELTANPGMAVAWAHLIFNLSVAIGFLLVLTWVEPL
LRKWLGADVRTARSEPAS