Protein Info for H281DRAFT_01675 in Paraburkholderia bryophila 376MFSha3.1

Annotation: PAS/PAC sensor hybrid histidine kinase (EC 2.7.13.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 840 PF13185: GAF_2" amino acids 42 to 175 (134 residues), 42.3 bits, see alignment E=4.4e-14 PF01590: GAF" amino acids 43 to 174 (132 residues), 28 bits, see alignment E=1.5e-09 TIGR00229: PAS domain S-box protein" amino acids 216 to 339 (124 residues), 80 bits, see alignment E=8.2e-27 amino acids 343 to 464 (122 residues), 54.8 bits, see alignment E=5.1e-19 PF00989: PAS" amino acids 220 to 332 (113 residues), 51.3 bits, see alignment E=5.5e-17 amino acids 344 to 455 (112 residues), 29 bits, see alignment E=4.5e-10 PF08448: PAS_4" amino acids 225 to 335 (111 residues), 25.1 bits, see alignment E=8.5e-09 amino acids 350 to 461 (112 residues), 38.7 bits, see alignment E=5.4e-13 PF13426: PAS_9" amino acids 230 to 334 (105 residues), 57 bits, see alignment E=1.1e-18 amino acids 356 to 457 (102 residues), 34.6 bits, see alignment E=9.4e-12 PF08447: PAS_3" amino acids 367 to 450 (84 residues), 29.3 bits, see alignment E=4.4e-10 PF00512: HisKA" amino acids 472 to 534 (63 residues), 37.6 bits, see alignment 9.2e-13 PF02518: HATPase_c" amino acids 583 to 694 (112 residues), 76.5 bits, see alignment E=1.1e-24 PF00072: Response_reg" amino acids 720 to 831 (112 residues), 63.6 bits, see alignment E=9.4e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to bgf:BC1003_3853)

Predicted SEED Role

"multi-sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (840 amino acids)

>H281DRAFT_01675 PAS/PAC sensor hybrid histidine kinase (EC 2.7.13.3) (Paraburkholderia bryophila 376MFSha3.1)
MTTSQDPQVESDIAVQLAAERSTNARLLKLINAHSKIAATKLNLDTFFSVVTDALLDLVP
AAHASVVEWVDGDDMVYRACSGSIARHVGLRLKREGSLSGLCSVENKLLYCRNTSNDPRV
DRQACERVGAASMIVAPLAYHAEVAGVVKLMADTHDAFSAEDIQTLERITSLVASGMAHQ
RVFAENQTLIEENAITIAKLRTEIGLREAADKRLASSLRRRRLVLDTTHDAFICTDSNGI
IIDWNDAANRTFGYSRDAVIGQPMLSLLFPERCKAEYAQLDIFEFDRKQPGHSPRTELTA
ARSDGSEFPAELSVAAVQYDGSKELAYFVRDITERFNARDLDKRFRVLVDAISDYAITLL
DADGFITTWSAGSVHVMGYHADEVIGKPHSLFYTPEDVSVGRPQKDLDQAAREGRSEMEE
WRVRKNGTNFWANTIVTALRDPNGALQGFAKITRDMSRRRRMEELEASSQRMSQFLGLLG
HELRNPLAPLRNAVSMLQLKSKGHEAFLPEHELIDRQLSHLTRLVDDLLDAGRVTLGRVH
ITPTPCALQAVVQLSIEGSAPLLAARNQTLNVSMPDEPMRVNGDLTRLVQVVQNLLNNAS
KFSPIGASIDLTVFRSARLLAIRIDDPGRGIEPDAIDAMFNLFVQETPTEEQADKSGLGI
GLTLARAIVDLHGGHIDARSAGRGKGSSFTVWLPGYESEVADEETRENPPVAPPQANLRV
LVVDDNNDSADSMAALVEVLGHESRAVYDGAAAVELAKQWQPALVLLDLSMPKITGFDAL
PQIRAALHEPGAVIAAMTGLGTSEDRARTAAAGFDLHLTKPVGLDDLEDVLRLAGKSSVT