Protein Info for H281DRAFT_01667 in Paraburkholderia bryophila 376MFSha3.1

Annotation: DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 47 to 389 (343 residues), 128.3 bits, E=4.3e-41
• PF12897: Asp_aminotransf
  • amino acids 117 to 385 (269 residues), 37.6 bits, E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 81% identity to bug:BC1001_5036)

Predicted SEED Role

"Aromatic-amino-acid aminotransferase (EC 2.6.1.57)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 2.6.1.57)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-tyrosine degradation I (5/5 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
• 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
• L-tyrosine degradation II (1/2 steps found)
• atromentin biosynthesis (1/2 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-phenylalanine degradation II (anaerobic) (1/3 steps found)
• L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
• L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
• L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• rosmarinic acid biosynthesis I (2/10 steps found)
• (S)-reticuline biosynthesis I (1/11 steps found)
• tropane alkaloids biosynthesis (1/11 steps found)
• superpathway of rosmarinic acid biosynthesis (3/14 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (6/27 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Lysine biosynthesis
• Methionine metabolism
• Novobiocin biosynthesis
• Phenylalanine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57

Use Curated BLAST to search for 2.6.1.57

Protein Sequence (409 amino acids)

>H281DRAFT_01667 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain (Paraburkholderia bryophila 376MFSha3.1)
MYEFTAPFQDPSGSPIRELFKYLAEPGMISFAGGYPASDLFDVDGLASAQKRAYRNSNRC
LQYGPTDGLPELKSELVNLMARRGVTCEPGELLVTTGSQQGLDLLLRVLVAPGDVVVTEQ
PAYPATLQALKLQHAQIVTAQVDGHGIDVENLAAHLESGAVPRPKLLYTVPTFANPTGAT
ITRERRIELLKLAVKYRFVIVEDDPYGDLRFSGDTVPSILALTAEVEGSRDWVVHFASLS
KIVAPGVRVGWSIAPAEITRRCVIAKQTVDLCSAPWTQAIAAEYLADGALERHLPRITTT
YRRKCDALCNELRWQLDDAIQFHQPEGGMFVWARIEGIDSSELLWHAIENKVIFVPGKAF
FADKLDVASLRLSFAAPGVEEIQEGARRLKRAYEAALAAGTSSVQSSGS