Protein Info for H281DRAFT_01666 in Paraburkholderia bryophila 376MFSha3.1
Annotation: 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to HOA1_BURL3: 4-hydroxy-2-oxovalerate aldolase 1 (Bcep18194_B1188) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 94% identity to bug:BC1001_0836)MetaCyc: 83% identical to 4-hydroxy-2-oxovalerate aldolase (Pseudomonas putida F1)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]
Predicted SEED Role
"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)
MetaCyc Pathways
- meta cleavage pathway of aromatic compounds (9/10 steps found)
- catechol degradation II (meta-cleavage pathway) (6/7 steps found)
- 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
- catechol degradation I (meta-cleavage pathway) (4/5 steps found)
- mandelate degradation to acetyl-CoA (13/18 steps found)
- toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
- L-tryptophan degradation IX (8/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (8/12 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (5/8 steps found)
- toluene degradation I (aerobic) (via o-cresol) (3/7 steps found)
- toluene degradation V (aerobic) (via toluene-cis-diol) (3/7 steps found)
- p-cumate degradation (3/8 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)
- naphthalene degradation to acetyl-CoA (5/12 steps found)
- p-cymene degradation (4/11 steps found)
- superpathway of aerobic toluene degradation (16/30 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (18/42 steps found)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- Benzoate degradation via hydroxylation
- Biphenyl degradation
- Carbazole degradation
- Ethylbenzene degradation
- Fluorene degradation
- Phenylalanine metabolism
- Styrene degradation
- Toluene and xylene degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.1.3.39
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (351 amino acids)
>H281DRAFT_01666 4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39) (Paraburkholderia bryophila 376MFSha3.1) MTSLDKKLYISDVTLRDGSHAVRHQYSIANVRAIARALDEAGVDSIEVAHGDGIEGSSFN YGFGAHSDVEWIAAAAESVKTAKIATLLIPGIGTIHDLRNAYDAGARVVRVATHCTEADV SRQHLEFARELGMDSVGFLMMSHMTTPQKLAMQAKLMERYGATCVYVVDSGGALGMADIR DRFRAFKDILNPETQTGMHAHHNLSLGVANSLVAVEEGCDRIDASLAGMGAGAGNAPLEV FIAAAQRLGWNHGCDLYRLMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHAELA ASKYGLKTVDILVELGRRKMVGGQEDMIVDVALDLLSHGAHKRDRSALHRA