Protein Info for H281DRAFT_01665 in Paraburkholderia bryophila 376MFSha3.1

Annotation: acetaldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03215: acetaldehyde dehydrogenase (acetylating)
  • amino acids 4 to 307 (304 residues), 471.7 bits, E=4e-146
• PF01408: GFO_IDH_MocA
  • amino acids 5 to 99 (95 residues), 24.5 bits, E=5.7e-09
• PF01118: Semialdhyde_dh
  • amino acids 6 to 118 (113 residues), 55.5 bits, E=1.2e-18
• PF09290: AcetDehyd-dimer
  • amino acids 129 to 282 (154 residues), 203.6 bits, E=2.1e-64

Best Hits

Swiss-Prot: 83% identical to ACDH1_BURL3: Acetaldehyde dehydrogenase 1 (Bcep18194_B1187) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K04073, acetaldehyde dehydrogenase [EC: 1.2.1.10] (inferred from 96% identity to bug:BC1001_0835)

MetaCyc: 71% identical to acetaldehyde dehydrogenase (acylating) (Pseudomonas sp. CF600)
Acetaldehyde dehydrogenase (acetylating). [EC: 1.2.1.10]

Predicted SEED Role

"Acetaldehyde dehydrogenase, acetylating, (EC 1.2.1.10) in gene cluster for degradation of phenols, cresols, catechol" in subsystem Biphenyl Degradation or Central meta-cleavage pathway of aromatic compound degradation (EC 1.2.1.10)

MetaCyc Pathways

• heterolactic fermentation (16/18 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• meta cleavage pathway of aromatic compounds (9/10 steps found)
• mixed acid fermentation (13/16 steps found)
• ethanolamine utilization (5/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• catechol degradation II (meta-cleavage pathway) (6/7 steps found)
• 2-aminoethylphosphonate degradation I (3/3 steps found)
• 2-deoxy-D-ribose degradation I (3/3 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• L-threonine degradation IV (2/2 steps found)
• ethanol degradation I (2/2 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• catechol degradation I (meta-cleavage pathway) (4/5 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• mandelate degradation to acetyl-CoA (13/18 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol III (2/3 steps found)
• toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
• L-tryptophan degradation IX (8/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (8/12 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (5/8 steps found)
• sulfoacetaldehyde degradation IV (1/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (3/6 steps found)
• superpathway of purine deoxyribonucleosides degradation (3/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (3/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (3/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• p-cumate degradation (3/8 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)
• triethylamine degradation (1/6 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• p-cymene degradation (4/11 steps found)
• superpathway of aerobic toluene degradation (16/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (18/42 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.10

Protein Sequence (320 amino acids)

>H281DRAFT_01665 acetaldehyde dehydrogenase (Paraburkholderia bryophila 376MFSha3.1)
MNEKVKVAIIGPGNIGTDLMIKVMRNSQHLEMAAMVGVDPKSDGLARAERMGVATTAEGI
DGLLKLDVFKNIDIVFDATSASAHKHHNDVLQKHGVQVIDLTPAAVGPYVIPAINLEAEN
ASNMNMVTCGGQATIPIVAAVSRVAKVHYAEIVASISSRSAGPGTRANIDEFTETTRSAI
ETLGGATRGKAIIVLNPAEPPLIMRDTVFVLSDLVDVNAVEDSVAQMITSVQAYVPGYRL
KQKIQFDIVSPEKPLNVPGLGVKHGLKTSVFLEVEGAAHYLPSYAGNLDIMTSAALACGD
MMARRRLAAGVVRGQKEPIQ