Protein Info for H281DRAFT_01653 in Paraburkholderia bryophila 376MFSha3.1

Annotation: Phenylpropionate dioxygenase, large terminal subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 299 to 318 (20 residues), see Phobius details PF00355: Rieske" amino acids 45 to 126 (82 residues), 73.4 bits, see alignment E=1.1e-24 PF00848: Ring_hydroxyl_A" amino acids 191 to 425 (235 residues), 65.9 bits, see alignment E=4.9e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to bgf:BC1003_3881)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>H281DRAFT_01653 Phenylpropionate dioxygenase, large terminal subunit (Paraburkholderia bryophila 376MFSha3.1)
MSTPTYQTIDTSALAKRAESDRIAPSLYYDPQLFEEELQRIFYRTWVWVAHDSELPKPGD
FVTTTIGRQPVIVVRDKTGAVNVLQNRCRHRGATVCEEHKGNAKGFTCPYHSWSYALDGT
LRALPYGDGYEGVCEKGDLPLKKLRVGVYQGLIFASFNEQIESLEDFLGGAKPWIDLFMK
QGAGYPIKANGEHKFKFKGNWKIQLENTTDLYHFPVVHKSWMKSIDDETAAVITSFMTSE
DAFCRSLGNGHSLAVLVPEIVDLDRDDGAPLPDRFNELAAQLSQKHTPEEVRRIVRSLMG
VGFNLNLFPNLALSMAFFRVLRPISAEETEIRHVALAMDGGPDEANRVRLRIHEHFQGPF
GFGSPDDAEAWERVQRGSYAGPDVPILVNRGLNRETAAPNGEKTAHATDETGMREAYRQW
RAMMEQA