Protein Info for H281DRAFT_01643 in Paraburkholderia bryophila 376MFSha3.1

Annotation: catechol 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02439: catechol 1,2-dioxygenase
  • amino acids 9 to 291 (283 residues), 444.4 bits, E=6.7e-138
• PF04444: Dioxygenase_N
  • amino acids 28 to 96 (69 residues), 79.4 bits, E=1.4e-26
• PF00775: Dioxygenase_C
  • amino acids 106 to 292 (187 residues), 199.1 bits, E=4.5e-63

Best Hits

Swiss-Prot: 81% identical to CATA1_ACILW: Catechol 1,2-dioxygenase 1 (catA1) from Acinetobacter lwoffii

KEGG orthology group: K03381, catechol 1,2-dioxygenase [EC: 1.13.11.1] (inferred from 87% identity to bgf:BC1003_3862)

MetaCyc: 56% identical to catechol-1,2-dioxygenase (Pseudomonas reinekei)
Catechol 1,2-dioxygenase. [EC: 1.13.11.1]

Predicted SEED Role

"Catechol 1,2-dioxygenase (EC 1.13.11.1)" in subsystem Catechol branch of beta-ketoadipate pathway (EC 1.13.11.1)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• mandelate degradation to acetyl-CoA (13/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (22/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Fluorobenzoate degradation
• Toluene and xylene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.1

Use Curated BLAST to search for 1.13.11.1

Protein Sequence (312 amino acids)

>H281DRAFT_01643 catechol 1,2-dioxygenase (Paraburkholderia bryophila 376MFSha3.1)
MMNVKVFATQEVQDLLKAAANLDSDKGDARTKQIAHRLLSDLFKAIDDLDITPDETWAGV
NYLNKLGQDGEAALLAAGLGLEKYLDIRMDAEDRQAEIDGGTPRTIEGPLYVEGAPVRDG
VSKIDLDADADAGPLVIRGTVRGPDGKPVAGAVVECWHANSKGFYSHFDPTGAQSPFNLR
GAVRTQDDGTYEFRTLMPVGYGCPPQGATQQLLNVLARHGNRPAHVHFFVKADGLRKLTT
QINIEGDPLIWDDFAYATREDLIPPVVGKSGGAALGLKDDAYKEIEFNFTLTPLVEGKDN
QLVNRLRTAAAA