Protein Info for H281DRAFT_01563 in Paraburkholderia bryophila 376MFSha3.1

Annotation: MFS transporter, CP family, cyanate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 50 to 74 (25 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 174 to 197 (24 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details PF07690: MFS_1" amino acids 56 to 393 (338 residues), 84.6 bits, see alignment E=3.2e-28

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 86% identity to bug:BC1001_5411)

Predicted SEED Role

"cyanate MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>H281DRAFT_01563 MFS transporter, CP family, cyanate transporter (Paraburkholderia bryophila 376MFSha3.1)
MKVPKTSANAEPTAADRGKIARPVAGAIAPHNSHNPHNPDEPHDSRARSIALAASLALIA
FSLRTPITSVGPILLEAVRATNLSRTGASVLTTLPSLCFGLFGPLAPLLARRLGSERALL
ALLLLLTLGTALRVFPVWEALYLGQIVACFAIGLMNVLLPGVVKRDFPHHVPLMTGVYSA
AMCVGAAAAAAGTVPAAHAIEYLLGGASGNSWAWALALWALPVALATLVWGVRLPKKSTH
AGRHAQVVRGLWRDPLAWKVTLFMGLQSSLAYIVFGWLPTVLRTRGMSAVDAGFMLSLSV
VTQAASSLLLPFLLTRLRDQRAVNVGALLSTGVGLMGCFFAPASTMWIWALLLGASQGAA
FTLALTVIGLRSYDSHVAAQLSSMAQGIGYLIASCGPFIAGSLLHATGSLYSLAALCAGI
CVVSAWFGYAAGRREHVNAHLESTH