Protein Info for H281DRAFT_01546 in Paraburkholderia bryophila 376MFSha3.1

Annotation: putative spermidine/putrescine transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00005: ABC_tran" amino acids 24 to 166 (143 residues), 126.8 bits, see alignment E=9.8e-41 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 39 to 356 (318 residues), 360.5 bits, see alignment E=3.8e-112 PF08402: TOBE_2" amino acids 276 to 355 (80 residues), 48.9 bits, see alignment E=5.9e-17

Best Hits

Swiss-Prot: 48% identical to CYSA2_CHRVO: Sulfate/thiosulfate import ATP-binding protein CysA 2 (cysA2) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_5240)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ML51 at UniProt or InterPro

Protein Sequence (358 amino acids)

>H281DRAFT_01546 putative spermidine/putrescine transport system ATP-binding protein (Paraburkholderia bryophila 376MFSha3.1)
MDARAKTGVSIRSAAKRYGPVIALDDVSLDIEPGEFVSLLGPSGSGKTTLLGILGGFVQP
TSGSVWVGERDITFAPPHKRNIGIVFQNYALFPHMTVGENVAFPLRARRDPKAGWAARVA
DALAMVELSGYESRGISQLSGGQRQRVALARAMVFEPQLILMDEPLSALDKQLRETMQIE
LRRLHRKLGATIVYVTHDQREALTMSDRVAVLKNGKLVQIDTPERLYDRPCDAFVASFIG
EATLLDVRRAGDDAVRLGDAVLRTAHPLPRGERLLLAVQTEKLVIDAGPAEPAANRLSCR
VTEVLYQGESLRVFATLADGTSISLRQPGNHNARSRIPSPGEHMTVVLDPQDTIVVPA