Protein Info for H281DRAFT_01518 in Paraburkholderia bryophila 376MFSha3.1

Annotation: D-mannonate dehydratase (EC 4.2.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF02746: MR_MLE_N" amino acids 14 to 110 (97 residues), 109.5 bits, see alignment E=1.2e-35 PF13378: MR_MLE_C" amino acids 136 to 377 (242 residues), 155.3 bits, see alignment E=2e-49

Best Hits

Swiss-Prot: 78% identical to MAND_ESCAT: D-galactonate dehydratase family member RspA (rspA) from Escherichia albertii (strain TW07627)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 97% identity to bpy:Bphyt_4722)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLE9 at UniProt or InterPro

Protein Sequence (402 amino acids)

>H281DRAFT_01518 D-mannonate dehydratase (EC 4.2.1.8) (Paraburkholderia bryophila 376MFSha3.1)
MKIVRADVIVTCPGRNFVTLKIVTDEGVHGIGDATLNGRELAVASYLKDHVCPLLIGRDP
GRIEDTWQYLYKGAYWRRGPVTMTAIAAVDMALWDILGKVTGMPLYKLLGGASREGVMVY
GHATGRDIPEALDRYAEHIEAGYQAIRIQCGVPNMRSVYGVSKGSGMYEPATKGAVEEQS
WSSEKYLDFVPKLFEAVREKFGFDTHLLHDVHHRLTPIEAARLGKSVEPYRLFWMEDPTP
AENQAGFRLIREHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRATLTHAGGISHLRRIAD
FASLYQVRTGCHGPSDLSPVCMGAALHFDLWVPNFGVQEYMGFPEEALEVFPHAWRFDHG
MMHPGDAPGHGVDIDEAAAARFPYDPAYLPVARLEDGTLWSW