Protein Info for H281DRAFT_01476 in Paraburkholderia bryophila 376MFSha3.1

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details PF03707: MHYT" amino acids 52 to 110 (59 residues), 66.3 bits, see alignment 3e-22 amino acids 115 to 164 (50 residues), 54.6 bits, see alignment 1.4e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 257 to 419 (163 residues), 146.8 bits, see alignment E=2.4e-47 PF00990: GGDEF" amino acids 259 to 415 (157 residues), 161.7 bits, see alignment E=2e-51 PF00563: EAL" amino acids 436 to 672 (237 residues), 244.9 bits, see alignment E=1.1e-76

Best Hits

Swiss-Prot: 51% identical to Y1727_PSEAE: Uncharacterized signaling protein PA1727 (PA1727) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 94% identity to bug:BC1001_5292)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5MLK2 at UniProt or InterPro

Protein Sequence (692 amino acids)

>H281DRAFT_01476 diguanylate cyclase/phosphodiesterase (Paraburkholderia bryophila 376MFSha3.1)
MQSSYNPWLVAMSFVVATLASYTALDLTGRIFVLASPRLRHVWRMGGAAALGVGIWSMHF
VAMLAFSLPIPLGYDFADTAYSLALAMGASYLALCLTTQVRITATRLLAGGAFMGAGIAG
MHYSGMAALRMSPGIGYRPAWFAASLAIAVGASTAALWMARALSNDDARHVLRKRFGAAL
VMGIAISGMHYAGMAAAEFAPDAICGAAAGVNAAWLATSVILFTFAILIVTLLLSRFDAR
TSFLVGAVSKLNGQILRLATLDTLTGLPNRATLTDRIERAIHASRRQRSLFAILFMDLDG
FKTINDSLGHSAGDQVLSAFAQRLLVCVRAGDTVARLGGDEFVVLSENLASRNDAAALAE
GVLERMRRDTWADSQPLQVMPSIGIALFPEDGDTVDTLLKHADAAMYEAKRAGRSTYRFF
ERSMNEAATRTLQIQNALREALAERHFTLHFQPKFDGKSESLAGAEALIRLHHPQLGTLA
PLEFIPIAERSGQIVQIGYWVLREACRQIRRWAAQGLPPVKVAINLSPRQLLQADLVPTM
LDIVKAEGVRCEQIMFEITETVAMHDAARTIDMLREFQASGFEIAIDDFGTGYSSLAYLQ
RFRVKQLKIDRFFTNGLDAHGAEGSAIVSAIIALAHSLEMDVVAEGVETETQLHMLKAMR
CDEMQGFLLGKPLTADDFGDFLRGTAVTAEVC