Protein Info for H281DRAFT_01453 in Paraburkholderia bryophila 376MFSha3.1

Annotation: carbohydrate ABC transporter membrane protein 1, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 109 to 311 (203 residues), 56.2 bits, see alignment E=2e-19

Best Hits

Swiss-Prot: 36% identical to Y1215_PYRHO: Probable ABC transporter permease protein PH1215 (PH1215) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 91% identity to bxe:Bxe_B2082)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z5ML09 at UniProt or InterPro

Protein Sequence (319 amino acids)

>H281DRAFT_01453 carbohydrate ABC transporter membrane protein 1, CUT1 family (Paraburkholderia bryophila 376MFSha3.1)
MHALKLHASRPGSASGSGSPKKPFKKPLKKRFSIAAWLALLPMILTVVFAYLGTMVWTAR
VSLSNSRTFPSGDFAGLTQYVRLFNNARWLLSLQNIVIYGACFIVACMVIGLLLAIFIDQ
RVVAEGALRTVFLYPYAMSFVATGLVWQWILNPELGAQAVLHKLGFVHARFDWIVDQDWA
IYTIVIATVWQASGLVMALLLAGLRGIDDELWKAARIDGIPRWRVYASIVVPMLGPSIST
AFVLLFVMVVKLYDAVVAMTQGGPGTASEVPAKFIMDYLFGRANIGLASAASIVLLATVL
AILTPFFYARSRAALRKEV